Gene Mb2688
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | gcn5-related n-acetyltransferase |
| Comments | Mb2688, -, len: 156 aa. Equivalent to Rv2669, len: 156 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 156 aa overlap). Conserved hypothetical protein, showing some similarity to various proteins e.g. Q9A6M0|CC2073 ACETYLTRANSFERASE (GNAT FAMILY) from Caulobacter crescentus (178 aa), FASTA scores: opt: 242, E(): 1.2e-09, (30.9% identity in 165 aa overlap); Q99RQ8|SA2159 hypothetical protein similar to transcription repressor of sporulation, septation and degradation paiA from Staphylococcus aureus subsp. aureus N315 (171 aa), FASTA scores: opt: 214, E(): 9.8e-08,(27.5% identity in 160 aa overlap); BAB58531|SAV2369 HYPOTHETICAL 20.1 KDA PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (171 aa), FASTA scores: opt: 214, E(): 9.8e-08, (27.5% identity in 160 aa overlap); P21340|PAIA_BACSU|O32112 PROTEASE SYNTHASE AND SPORULATION from Bacillus subtilis (171 aa), FASTA scores: opt: 209,E(): 2.1e-07, (22.85% identity in 162 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2941762 | 2942232 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2688|Mb2688
MTDADELAAVAARTFPLACPPAVAPEHIASFVDANLSSARFAEYLTDPRRAILTARHDGRIVGYAMLIRGDDRDVELSKLYLLPGYHGTGAAAALMHKVLATAADWGALRVWLGVNQKNQRAQRFYAKTGFKINGTRTFRLGAHHENDYVMVRELV
Bibliography
No article yet recorded
