Gene Rv2674
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine [catalytic activity: protein L-methionine + oxidized thioredoxin + H2O = protein-L-methionine-(R)-S-oxide + reduced thioredoxin] |
| Product | Probable peptide methionine sulfoxide reductase MsrB (protein-methionine-R-oxide reductase) (peptide met(O) reductase) |
| Comments | Rv2674, (MTCY441.43), len: 136 aa. Probable msrB, peptide methionine sulfoxide reductase (See Lee et al., 2008), highly similar to various proteins e.g. Q9X828|SC9B1.08 putative oxidoreductase from Streptomyces coelicolor (135 aa), FASTA scores: opt: 653, E(): 1.8e-37, (71.1% identity in 128 aa overlap); O26807|MTH711 transcriptional regulator from Methanothermobacter thermautotrophicus (151 aa), FASTA scores: opt: 533, E(): 2.7e-29, (58.15% identity in 129 aa overlap); Q9C5C8|AT4G21860 hypothetical 22.0 KDA protein from Arabidopsis thaliana (Mouse-ear cress) (202 aa), FASTA scores: opt: 490, E(): 2.8e-26, (54.05% identity in 124 aa overlap); P39903|YEAA_ECOLI|B1778|Z2817|ECS2487 hypothetical protein from Escherichia coli strains K12 and O157:H7 (137 aa), FASTA scores: opt: 426, E(): 4.4e-22, (46.8% identity in 126 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2990706 | 2991116 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2674|msrB
MTRPKLELSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHCGWPSFFDPKSSDAVTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRYCINSISLRLVPGSV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lee WL et al. [2009]. Mycobacterium tuberculosis expresses methionine sulphoxide reductases A and B that protect from killing by nitrite and hypochlorite. Function Mutant Product
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant