Gene Rv2678c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in porphyrin biosynthesis [catalytic activity: uroporphyrinogen III = coproporphyrinogen + 4 CO(2)]. |
| Product | Probable uroporphyrinogen decarboxylase HemE (uroporphyrinogen III decarboxylase) (URO-D) (UPD) |
| Comments | Rv2678c, (MTV010.02c), len: 357 aa. Probable hemE, uroporphyrinogen decarboxylase, equivalent to P46809|DCUP_MYCLE|heme|ML1043 uroporphyrinogen decarboxylase from Mycobacterium leprae (357 aa), FASTA scores: opt: 2017, E(): 8.2e-111, (83.75% identity in 357 aa overlap). Also highly similar to many e.g. O69861|DCUP_STRCO|heme|SC1C3.19 from Streptomyces coelicolor (355 aa), FASTA scores: opt: 1165, E(): 5.6e-61, (58.15% identity in 349 aa overlap); P32395|DCUP_BACSU|heme from Bacillus subtilis (353 aa), FASTA scores: opt: 859, E(): 4.5e-43, (44.1% identity in 356 aa overlap); Q9RV96|DCUP_DEIRA|heme|DR1133 from Deinococcus radiodurans (344 aa), FASTA scores: opt: 850, E(): 1.5e-42, (43.0% identity in 349 aa overlap); etc. Equivalent to AAK47067 from Mycobacterium tuberculosis strain CDC1551 (372 aa) but shorter 15 aa. Contains PS00907 Uroporphyrinogen decarboxylase signature 2. Belongs to the uroporphyrinogen decarboxylase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2993989 | 2995062 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2678c|hemE
MSTRRDLPQSPYLAAVTGRKPSRVPVWFMRQAGRSLPEYRALRERYSMLAACFEPDVACEITLQPIRRYDVDAAILFSDIVVPLRAAGVDLDIVADVGPVIADPVRTAADVAAMKPLDPQAIQPVLVAASLLVAELGDVPLIGFAGAPFTLASYLVEGGPSRHHAHVKAMMLAEPASWHALMAKLTDLTIAFLVGQIDAGVDAIQVFDSWAGALSPIDYRQYVLPHSARVFAALGEHGVPMTHFGVGTAELLGAMSEAVTAGERPGRGAVVGVDWRTPLTDAAARVVPGTALQGNLDPAVVLAGWPAVERAARAVVDDGRRAVDAGAAGHIFNLGHGVLPESDPAVLADLVSLVHSL
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
