Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in porphyrin biosynthesis [catalytic activity: uroporphyrinogen III = coproporphyrinogen + 4 CO(2)].
ProductProbable uroporphyrinogen decarboxylase HemE (uroporphyrinogen III decarboxylase) (URO-D) (UPD)
CommentsRv2678c, (MTV010.02c), len: 357 aa. Probable hemE, uroporphyrinogen decarboxylase, equivalent to P46809|DCUP_MYCLE|heme|ML1043 uroporphyrinogen decarboxylase from Mycobacterium leprae (357 aa), FASTA scores: opt: 2017, E(): 8.2e-111, (83.75% identity in 357 aa overlap). Also highly similar to many e.g. O69861|DCUP_STRCO|heme|SC1C3.19 from Streptomyces coelicolor (355 aa), FASTA scores: opt: 1165, E(): 5.6e-61, (58.15% identity in 349 aa overlap); P32395|DCUP_BACSU|heme from Bacillus subtilis (353 aa), FASTA scores: opt: 859, E(): 4.5e-43, (44.1% identity in 356 aa overlap); Q9RV96|DCUP_DEIRA|heme|DR1133 from Deinococcus radiodurans (344 aa), FASTA scores: opt: 850, E(): 1.5e-42, (43.0% identity in 349 aa overlap); etc. Equivalent to AAK47067 from Mycobacterium tuberculosis strain CDC1551 (372 aa) but shorter 15 aa. Contains PS00907 Uroporphyrinogen decarboxylase signature 2. Belongs to the uroporphyrinogen decarboxylase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29939892995062-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2678c|hemE
MSTRRDLPQSPYLAAVTGRKPSRVPVWFMRQAGRSLPEYRALRERYSMLAACFEPDVACEITLQPIRRYDVDAAILFSDIVVPLRAAGVDLDIVADVGPVIADPVRTAADVAAMKPLDPQAIQPVLVAASLLVAELGDVPLIGFAGAPFTLASYLVEGGPSRHHAHVKAMMLAEPASWHALMAKLTDLTIAFLVGQIDAGVDAIQVFDSWAGALSPIDYRQYVLPHSARVFAALGEHGVPMTHFGVGTAELLGAMSEAVTAGERPGRGAVVGVDWRTPLTDAAARVVPGTALQGNLDPAVVLAGWPAVERAARAVVDDGRRAVDAGAAGHIFNLGHGVLPESDPAVLADLVSLVHSL