Gene Rv2688c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of unidentified antibiotic across the membrane (export): antibiotic resistance by an export mechanism. Responsible for energy coupling to the transport system. |
| Product | Antibiotic-transport ATP-binding protein ABC transporter |
| Comments | Rv2688c, (MTCY05A6.09c), len: 301 aa. Antibiotic-transport ATP-binding protein ABC transporter (see citation below), highly similar to AAK47077|MT2762 ABC transporter ATP-binding protein from Mycobacterium tuberculosis strain CDC1551 (317 aa), FASTA scores: opt: 1714, E(): 5.1e-93, (95.6% identity in 274 aa overlap). Also highly similar to other ATP-binding proteins ABC transporter e.g. Q9K639|BH3893 from Bacillus halodurans (282 aa), FASTA scores: opt: 644, E(): 1.4e-30, (38.% identity in 285 aa overlap); O58550|PH0820 from Pyrococcus horikoshii (312 aa), FASTA scores: opt: 574, E(): 1.8e-26, (39.1% identity in 307 aa overlap); Q9WYM0|TM0389 from Thermotoga maritima (301 aa), FASTA scores: opt: 536, E(): 2.9e-24, (36.1% identity in 291 aa overlap); etc. Has ATP/GTP-binding site motif A (P-loop) at N-terminus (PS00017). Belongs to the ATP-binding transport protein family (ABC transporters). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3004745 | 3005650 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2688c|Rv2688c
MTALNRAVASARVGTEVIRVRGLTFRYPKAAEPAVRGMEFTVGRGEIFGLLGPSGAGKSTTQKLLIGLLRDHGGQATVWDKEPAEWGPDYYERIGVSFELPNHYQKLTGYENLRFFASLYAGATADPMQLLAAVGLADDAHTLVGKYSKGMQMRLPFARSLINDPELLFLDEPTSGLDPVNARKIKDIIVDLKARGRTIFLTTHDMATADELCDRVAFVVDGRIVALDSPTELKIARSRRRVRVEYRGDGGGLETAEFGMDGLADDPAFHSVLRNHHVETIHSREASLDDVFVEVTGRQLT
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
