Gene Mb2707c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | antibiotic-transport atp-binding protein abc transporter |
| Comments | Mb2707c, -, len: 301 aa. Equivalent to Rv2688c,len: 301 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 301 aa overlap). Probable antibiotic-transport ATP-binding protein ABC transporter (see citation below), highly similar to AAK47077|MT2762 ABC TRANSPORTER ATP-BINDING PROTEIN from Mycobacterium tuberculosis strain CDC1551 (317 aa), FASTA scores: opt: 1714, E(): 5.1e-93, (95.6% identity in 274 aa overlap). Also highly similar to other ATP-BINDING PROTEINS ABC TRANSPORTER e.g. Q9K639|BH3893 from Bacillus halodurans (282 aa), FASTA scores: opt: 644, E(): 1.4e-30, (38.% identity in 285 aa overlap); O58550|PH0820 from Pyrococcus horikoshii (312 aa), FASTA scores: opt: 574, E(): 1.8e-26,(39.1% identity in 307 aa overlap); Q9WYM0|TM0389 from Thermotoga maritima (301 aa), FASTA scores: opt: 536, E(): 2.9e-24, (36.1% identity in 291 aa overlap); etc. Has ATP/GTP-binding site motif A (P-loop) at N-terminus (PS00017). BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2961381 | 2962286 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2707c|Mb2707c
MTALNRAVASARVGTEVIRVRGLTFRYPKAAEPAVRGMEFTVGRGEIFGLLGPSGAGKSTTQKLLIGLLRDHGGQATVWDKEPAEWGPDYYERIGVSFELPNHYQKLTGYENLRFFASLYAGATADPMQLLAAVGLADDAHTLVGKYSKGMQMRLTFARSLINDPELLFLDEPTSGLDPVNARKIKDIIVDLKARGRTIFLTTHDMATADELCDRVAFVVDGRIVALDSPTELKIARSRRRVRVEYRGDGGGLETAEFGMDGLADDPAFHSVLRNHHVETIHSREASLDDVFVEVTGRQLT
Bibliography
No article yet recorded