Gene Rv2693c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane alanine and leucine rich protein |
| Comments | Rv2693c, (MTCY05A6.14c), len: 223 aa. Probable conserved integral membrane ala-, leu-rich protein, showing some similarity to O54140|SC2E9.15 hypothetical 29.6 KDA protein from Streptomyces coelicolor (272 aa), FASTA scores: opt: 212, E(): 4.3e-06, (23.5% identity in 247 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3010697 | 3011368 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2693c|Rv2693c
VNANRTSAQRLLAQAGGVSGLVYSSLPVVTFVVASSAAGLLPAIGFALSMAGLILLWRLLRRESARPVVAGFCGVAVCALIAYLVGQSKGYFLLGIWMSLLWAVVFTLSILIRRPIVGYLWSWLSGRDRAWRDVSRAVFAFDVATLGWTLVFAARFIVQRHLYDADKTGWLGVARIGMGWPLTALAALATYAAIKAAQRAILASHDAAAVGGAAEFDADAGRE
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
