Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyzes the phosphorylation of glucose using polyphosphate or ATP as the phosphoryl donor. GTP, UTP and CTP can replace ATP as phosphoryl donor [catalytic activity: (phosphate)(N) + D-glucose = (phosphate)(N-1) + D-glucose 6-phosphate].
ProductPolyphosphate glucokinase PpgK (polyphosphate-glucose phosphotransferase)
CommentsRv2702, (MTCY05A6.23), len: 265 aa. PpgK, polyphosphate glucokinase (see citations below), equivalent, but shorter 60 aa, to Q49988|PPGK_MYCLE|ML1023|U1764FG polyphosphate glucokinase from Mycobacterium leprae (324 aa), FASTA scores: opt: 1411, E(): 5.6e-80, (82.8% identity in 262 aa overlap). Also highly similar (or just similar) to others e.g. Q9ADE8|PPGK from Streptomyces coelicolor (246 aa), FASTA scores: opt: 912, E(): 3e-49, (57.3% identity in 239 aa overlap); Q9AGV8|PPGK from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (277 aa), FASTA scores: opt: 890, E(): 7.5e-48, (57.75% identity in 239 aa overlap); P40184|GLK_STRCO|SC6E10.20c from Streptomyces coelicolor (317 aa), FASTA scores: opt: 233, E(): 3.2e-07, (31.3% identity in 163 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain and no virulence modification seen in SCID mice (see McAdam et al., 2002). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30168583017655+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2702|ppgK
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTILNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDWTYPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIVGAAMASVADTTH
      
Bibliography