Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2735c, (MTCY154.15c), len: 330 aa. Conserved hypothetical protein, showing some similarity with Q98DH2|MLR4706 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (302 aa), FASTA scores: opt: 140, E(): 0.062, (27.0% identity in 200 aa overlap); and Q9PHA1|XF0043 hypothetical protein from Xylella fastidiosa (293 aa), FASTA scores: opt: 120, E(): 1.2, (30.75% identity in 117 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30475603048552-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2735c|Rv2735c
MAREWSYWTRNKLEILAGYLPAFNRASQTSRERIYLDLMAGQPENIDRDMGEKFDGSSLIAMKADPPFTRLRFCELNPLASELDVALRTRFPGDGRYRVVAGDSNVTIDETLAELGPWRWAPTFAFIDQQAAEVHWETINKVAAFRQNPRNLKTELWMLMSPTMIARGVKGTNAELFIEQVTRMYGDADWKRIQAARWRHHLTAPAYRAEMVNLMRVKLEYELGYKYSHRIPMQMHNKVTIFDMVFATDHWAGDAIMCHLYNRAAQKEPEMMRQAKSAKQQKESEDRGEMGLFSVGELAVQDSNAGQILWAPSPTWDPRARGWWSEDPGF