Gene Rv2735c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2735c, (MTCY154.15c), len: 330 aa. Conserved hypothetical protein, showing some similarity with Q98DH2|MLR4706 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (302 aa), FASTA scores: opt: 140, E(): 0.062, (27.0% identity in 200 aa overlap); and Q9PHA1|XF0043 hypothetical protein from Xylella fastidiosa (293 aa), FASTA scores: opt: 120, E(): 1.2, (30.75% identity in 117 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3047560 | 3048552 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2735c|Rv2735c
MAREWSYWTRNKLEILAGYLPAFNRASQTSRERIYLDLMAGQPENIDRDMGEKFDGSSLIAMKADPPFTRLRFCELNPLASELDVALRTRFPGDGRYRVVAGDSNVTIDETLAELGPWRWAPTFAFIDQQAAEVHWETINKVAAFRQNPRNLKTELWMLMSPTMIARGVKGTNAELFIEQVTRMYGDADWKRIQAARWRHHLTAPAYRAEMVNLMRVKLEYELGYKYSHRIPMQMHNKVTIFDMVFATDHWAGDAIMCHLYNRAAQKEPEMMRQAKSAKQQKESEDRGEMGLFSVGELAVQDSNAGQILWAPSPTWDPRARGWWSEDPGF
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant