Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in biosynthesis of diaminopimelate and lysine from aspartate semialdehyde (at the first step) [catalytic activity: L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2 H(2)O].
ProductProbable dihydrodipicolinate synthase DapA (DHDPS) (dihydrodipicolinate synthetase)
CommentsRv2753c, (MT2823, MTV002.18c), len: 300 aa. Probable dapA, dihydrodipicolinate synthase, equivalent to Q9CBW4|DAPA_MYCLE|ML1513 dihydrodipicolinate synthase from Mycobacterium leprae (300 aa), FASTA scores: opt: 1699, E(): 2.2e-98, (86.65% identity in 300 aa overlap). Also highly similar to many e.g. P19808|DAPA_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (301 aa), FASTA scores: opt: 1089, E(): 2e-60, (58.7% identity in 288 aa overlap); O86841|DAPA_STRCO|SC9A10.08 from Streptomyces coelicolor (299 aa), FASTA scores: opt: 1044, E(): 1.3e-57, (55.75% identity in 287 aa overlap); P05640|DAPA_ECOLI (292 aa), FASTA scores: opt: 515, E(): 0, (33.8% identity in 287 aa overlap); etc. Contains PS00665 and PS00666 Dihydrodipicolinate synthetase signatures 1 and 2. Belongs to the DHDPS family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30662223067124-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2753c|dapA
VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKINIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR