Gene Rv2753c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in biosynthesis of diaminopimelate and lysine from aspartate semialdehyde (at the first step) [catalytic activity: L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2 H(2)O]. |
| Product | Probable dihydrodipicolinate synthase DapA (DHDPS) (dihydrodipicolinate synthetase) |
| Comments | Rv2753c, (MT2823, MTV002.18c), len: 300 aa. Probable dapA, dihydrodipicolinate synthase, equivalent to Q9CBW4|DAPA_MYCLE|ML1513 dihydrodipicolinate synthase from Mycobacterium leprae (300 aa), FASTA scores: opt: 1699, E(): 2.2e-98, (86.65% identity in 300 aa overlap). Also highly similar to many e.g. P19808|DAPA_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (301 aa), FASTA scores: opt: 1089, E(): 2e-60, (58.7% identity in 288 aa overlap); O86841|DAPA_STRCO|SC9A10.08 from Streptomyces coelicolor (299 aa), FASTA scores: opt: 1044, E(): 1.3e-57, (55.75% identity in 287 aa overlap); P05640|DAPA_ECOLI (292 aa), FASTA scores: opt: 515, E(): 0, (33.8% identity in 287 aa overlap); etc. Contains PS00665 and PS00666 Dihydrodipicolinate synthetase signatures 1 and 2. Belongs to the DHDPS family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3066222 | 3067124 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2753c|dapA
VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKINIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Kefala G et al. [2008]. Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis. Function Product Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant