Gene Rv2762c 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Function unknown | 
| Product | Conserved hypothetical protein | 
| Comments | Rv2762c, (MTV002.27c), len: 139 aa. Conserved hypothetical protein, similar to C-terminus of hypothetical proteins: Q9A380|CC3324 from Caulobacter crescentus (409 aa), FASTA scores: opt: 181, E(): 9.8e-05, (43.55% identity in 101 aa overlap); Q98KQ4|MLR1373 from Rhizobium loti (Mesorhizobium loti) (399 aa), FASTA scores: opt: 174, E(): 0.00028, (46.35% identity in 82 aa overlap); and Q9HZZ9|PA2844 from Pseudomonas aeruginosa (402 aa), FASTA scores: opt: 158, E(): 0.0033, (40.0% identity in 80 aa overlap). | 
| Functional category | Conserved hypotheticals | 
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3072637 | 3073056 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2762c|Rv2762c
MSAATAAWDRRAAVVVGGVAEPGSAGPIAGADRKRLISRIQVRQLDSAAVAAKRRHLYYVRPLDGHPVARVDRKTDRAADSLPVAGVLGELDIPPVTVAEGLAGELASMASWLGLGGIAVSTRGDLAGELCAATKRTNG
      
    Bibliography
    - Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant