Gene Rv2769c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE27 |
| Comments | Rv2769c, (MTV002.34c), len: 275 aa. PE27, Member of the Mycobacterium tuberculosis PE family (see citation below), highly similar to many (notably in N-terminal part) e.g. P96361|Rv1040c|MTCY10G2.09 from Mycobacterium tuberculosis (275 aa), FASTA scores: opt: 1111, E(): 5.9e-52, (68.55% identity in 283 aa overlap). |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3078158 | 3078985 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2769c|PE27
MSFLTTQPEELAAAAGKLETIGSAMVAQNAAAAAPTTTGVIPAAADEISVLQAPLFTAYGTLYQQVSAEAAAVYDLFVKTLGVSAGTYAATEAANSSAAASPLSGIASILGSTPGKVPSWISDIANIFNIGAGNWASAASDLLGLASGGLLPAAEEAALEEGLEGAGLSELGAAEAAVGEAPIAAGLGAAPLAAGLSRASSIGALSVPPSWAGQANLVSSTSTLQGAGWTTAAPHGAAGTVIPGMPGLASATRSSAGFGAPRYGAKPIVVPKPAV
Bibliography
- Gold B et al. [2001]. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Regulon
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
