Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE family protein PE27
CommentsRv2769c, (MTV002.34c), len: 275 aa. PE27, Member of the Mycobacterium tuberculosis PE family (see citation below), highly similar to many (notably in N-terminal part) e.g. P96361|Rv1040c|MTCY10G2.09 from Mycobacterium tuberculosis (275 aa), FASTA scores: opt: 1111, E(): 5.9e-52, (68.55% identity in 283 aa overlap).
Functional categoryPe/ppe
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30781583078985-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2769c|PE27
MSFLTTQPEELAAAAGKLETIGSAMVAQNAAAAAPTTTGVIPAAADEISVLQAPLFTAYGTLYQQVSAEAAAVYDLFVKTLGVSAGTYAATEAANSSAAASPLSGIASILGSTPGKVPSWISDIANIFNIGAGNWASAASDLLGLASGGLLPAAEEAALEEGLEGAGLSELGAAEAAVGEAPIAAGLGAAPLAAGLSRASSIGALSVPPSWAGQANLVSSTSTLQGAGWTTAAPHGAAGTVIPGMPGLASATRSSAGFGAPRYGAKPIVVPKPAV