Gene Rv2775
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acetylation, substrate unknown |
| Product | GCN5-related N-acetyltransferase |
| Comments | Rv2775, (MTV002.40), len: 153 aa. Probable acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Showing weak similarity to other hypothetical proteins e.g. Q9ZBJ7|SC9C7.13c from Streptomyces coelicolor (179 aa), FASTA scores: opt: 167, E(): 0.00024, (29.05% identity in 148 aa overlap). Equivalent to AAK47164 from Mycobacterium tuberculosis strain CDC1551 (185 aa) but shorter 32 aa. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3082909 | 3083370 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2775|Rv2775
MHYPVWRQSWTGILDPYLLDMIGSPKLWVEESYPQSLKRGGWSMWIAESGGQPIGMTMFGPDIAHPDRIQIDALYVAENSQRHGIGGRLLNRALHSHPSADMILWCAEKNSKARGFYEKKDFHIDGRTFTWKPLSGVNVPHVGYRLYRSAPPG
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
