Gene Mb2797
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | gcn5-related n-acetyltransferase |
| Comments | Mb2797, -, len: 153 aa. Equivalent to Rv2775, len: 153 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 153 aa overlap). Hypothetical unknown protein, showing weak similarity with hypothetical proteins e.g. Q9ZBJ7|SC9C7.13c from Streptomyces coelicolor (179 aa), FASTA scores: opt: 167, E(): 0.00024,(29.05% identity in 148 aa overlap). Equivalent to AAK47164 from Mycobacterium tuberculosis strain CDC1551 (185 aa) but shorter 32 aa. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3039483 | 3039944 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2797|Mb2797
MHYPVWRQSWTGILDPYLLDMIGSPKLWVEESYPQSLKRGGWSMWIAESGGQPIGMTMFGPDIAHPDRIQIDALYVAENSQRHGIGGRLLNRALHSHPSADMILWCAEKNSKARGFYEKKDFHIDGRTFTWKPLSGVNVPHVGYRLYRSAPPG
Bibliography
No article yet recorded