Gene Rv2779c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (probably Lrp/AsnC-family) |
| Comments | Rv2779c, (MTV002.44c), len: 179 aa. Possible transcriptional regulator, from the Lrp/AsnC family, similar (but longer ~30 aa in N-terminus) to others e.g. CAC42842|SCBAC36F5.06 putative AsnC-family transcriptional regulatory protein from Streptomyces coelicolor (163 aa), FASTA scores: opt: 333, E(): 4.4e-16, (39.7% identity in 141 aa overlap); O07920|AZLB_BACSU transcriptional regulator (AsnC family) from Bacillus subtilis; Q9I233|PA2082 probable transcriptional regulator (AsnC family) from Pseudomonas aeruginosa (158 aa), FASTA scores: opt: 322, E(): 2.5e-15, (33.1% identity in 148 aa overlap); etc. Also similar to P96896|Rv3291c|MTCY71.31c from Mycobacterium tuberculosis (33.3% identity in 120 aa overlap). Equivalent to AAK47168 from Mycobacterium tuberculosis strain CDC1551 (181 aa). Seems to belong to the AsnC family of transcriptional regulators. Start changed since first submission (+8 aa). |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3086215 | 3086754 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2779c|Rv2779c
MIILFRGHMRDNSTEHKTRRAASSKDVRPAELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAPI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant