Gene Rv2785c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanism. This protein is one of the 16S ribosomal RNA binding proteins. |
| Product | 30S ribosomal protein S15 RpsO |
| Comments | Rv2785c, (MTV002.50c), len: 89 aa. rpsO, 30s ribosomal protein S15, equivalent to O32967|RS15_MYCLE|RPSO|ML0853|MLCB22.28c 30S ribosomal protein S15 from Mycobacterium leprae (89 aa), FASTA scores: opt: 522, E(): 7.4e-34, (92.15% identity in 89 aa overlap). Also highly similar to many e.g. O86655|RS15_STRCO|RPSO|SC3C3.22 from Streptomyces coelicolor (95 aa), FASTA scores: opt: 408, E(): 6.7e-25, (62.9% identity in 89 aa overlap); P05766|RS15_BACST|RPSO from Bacillus stearothermophilus (88 aa), FASTA scores: opt: 385, E(): 4e-23, (62.5% identity in 88 aa overlap); P21473|RS15_BACSU|RPSO from Bacillus subtilis (88 aa), FASTA scores: opt: 351, E(): 1.9e-20, (57.95% identity in 88 aa overlap); P02371|RS15_ECOLI|RPSO|sec|B3165 from Escherichia coli strain K12 (88 aa), FASTA scores: opt: 295, E(): 4.5e-22, (52.3% identity in 88 aa overlap); etc. Contains PS00362 Ribosomal protein S15 signature. Belongs to the S15P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3093479 | 3093748 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2785c|rpsO
VALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLRR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
