Gene Mb2808c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s15 rpso |
| Comments | Mb2808c, rpsO, len: 89 aa. Equivalent to Rv2785c,len: 89 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 89 aa overlap). Probable rpsO, 30s ribosomal protein S15, equivalent to O32967|RS15_MYCLE|RPSO|ML0853|MLCB22.28c 30S RIBOSOMAL PROTEIN S15 from Mycobacterium leprae (89 aa), FASTA scores: opt: 522, E(): 7.4e-34, (92.15% identity in 89 aa overlap). Also highly similar to many e.g. O86655|RS15_STRCO|RPSO|SC3C3.22 from Streptomyces coelicolor (95 aa), FASTA scores: opt: 408, E(): 6.7e-25,(62.9% identity in 89 aa overlap); P05766|RS15_BACST|RPSO from Bacillus stearothermophilus (88 aa), FASTA scores: opt: 385, E(): 4e-23, (62.5% identity in 88 aa overlap); P21473|RS15_BACSU|RPSO from Bacillus subtilis (88 aa),FASTA scores: opt: 351, E(): 1.9e-20, (57.95% identity in 88 aa overlap); P02371|RS15_ECOLI|RPSO|SEC|B3165 from Escherichia coli strain K12 (88 aa), FASTA scores: opt: 295, E(): 4.5e-22, (52.3% identity in 88 aa overlap); etc. Contains PS00362 Ribosomal protein S15 signature. BELONGS TO THE S15P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3050028 | 3050297 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2808c|rpsO
MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLRR
Bibliography
No article yet recorded