Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in translation mechanism. This protein is one of the 16S ribosomal RNA binding proteins.
Product30S ribosomal protein S15 RpsO
CommentsRv2785c, (MTV002.50c), len: 89 aa. rpsO, 30s ribosomal protein S15, equivalent to O32967|RS15_MYCLE|RPSO|ML0853|MLCB22.28c 30S ribosomal protein S15 from Mycobacterium leprae (89 aa), FASTA scores: opt: 522, E(): 7.4e-34, (92.15% identity in 89 aa overlap). Also highly similar to many e.g. O86655|RS15_STRCO|RPSO|SC3C3.22 from Streptomyces coelicolor (95 aa), FASTA scores: opt: 408, E(): 6.7e-25, (62.9% identity in 89 aa overlap); P05766|RS15_BACST|RPSO from Bacillus stearothermophilus (88 aa), FASTA scores: opt: 385, E(): 4e-23, (62.5% identity in 88 aa overlap); P21473|RS15_BACSU|RPSO from Bacillus subtilis (88 aa), FASTA scores: opt: 351, E(): 1.9e-20, (57.95% identity in 88 aa overlap); P02371|RS15_ECOLI|RPSO|sec|B3165 from Escherichia coli strain K12 (88 aa), FASTA scores: opt: 295, E(): 4.5e-22, (52.3% identity in 88 aa overlap); etc. Contains PS00362 Ribosomal protein S15 signature. Belongs to the S15P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30934793093748-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2785c|rpsO
VALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLRR