Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionBiosynthesis of fatty acids and lipids. Transfers the 4'-phosphopantetheine moiety from coenzyme A to a SER of acyl-carrier protein. Catalyzes the formation of holo-ACP, which mediates the transfer of acyl fatty-acid intermediates during the biosynthesis of fatty acids and lipids [catalytic activity: CoA + APO-[acyl-carrier protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier protein] ].
ProductPhosphopantetheinyl transferase PptT (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)
CommentsRv2794c, (MTV002.59c), len: 227 aa. PptT, phosphopantetheinyl transferase, equivalent to Q9Z5I5|ML1547|MLCB596.23 putative iron-chelating complex subunit from Mycobacterium leprae (227 aa), FASTA scores: opt: 1248, E(): 9.1e-77, (79.75% identity in 227 aa overlap). Also highly similar to various proteins e.g. Q9F0Q6|PPTA phosphopantetheinyl transferase from Streptomyces verticillus (246 aa), FASTA scores: opt: 692, E(): 2.8e-39, (46.65% identity in 225 aa overlap); O88029|SC5A7.23 hypothetical 24.5 KDA protein from Streptomyces coelicolor (226 aa), FASTA scores: opt: 679, E(): 2e-38, (46.9% identity in 226 aa overlap); O24813 DNA for L-proline 3-hydroxylase from Streptomyces sp. (208 aa), FASTA scores: opt: 631, E(): 3.2e-35, (48.1% identity in 208 aa overlap); etc.
Functional categoryLipid metabolism
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene in M. smegmatis and M. bovis BCG; C. glutamicum mutant does not produce corynomycolates, has altered colony morphology and slower growth rate compared to wild-type (See Chalut et al., 2006). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31032573103940-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2794c|pptT
MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL