Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv2827c, (MTCY16B7.15), len: 295 aa. Hypothetical unknown protein, equivalent to AAK47219 from Mycobacterium tuberculosis strain CDC1551 (315 aa) but shorter 20 aa.
Functional categoryConserved hypotheticals
MutantDisruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31345963135483-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2827c|Rv2827c
VVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSRDRGESVWAPEYQLVDELVVPLLRVIGKA