Gene Rv2832c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of Sn-glycerol-3-phosphate across the membrane (import). Responsible for energy coupling to the transport system. |
| Product | Probable Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UgpC |
| Comments | Rv2832c, (MTCY16B7.10), len: 360 aa. Probable ugpC, Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter (see Braibant et al., 2000), similar to others: CAC48805 probable glycerol-3-phosphate ABC transporter ATP-binding protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (349 aa), FASTA scores: opt: 1018, E(): 4.1e-53, (48.6% identity in 356 aa overlap); Q98G42|MLL3499|UGPC SN-glycerol-3-phosphate transport ATP-binding protein from Rhizobium loti (Mesorhizobium loti) (366 aa), FASTA scores: opt: 1016, E(): 5.6e-53, (48.5% identity in 367 aa overlap). But also highly similar to many msiK proteins, ABC transporter ATP-binding proteins possibly involved in transport of cellolbiose and maltose (see Schlosser et al., 1997) e.g. P96483|MSIK MSIK protein from Streptomyces reticuli (377 aa), FASTA scores: opt: 1277, E(): 1.9e-68, (58.05% identity in 379 aa overlap); Q9L0Q1|MSIK ABC transporter ATP-binding protein from Streptomyces coelicolor (378 aa), FASTA scores: opt: 1276, E(): 2.1e-68, (57.65% identity in 380 aa overlap); Q54333|MSIK from Streptomyces lividans (314 aa), FASTA scores: opt: 1217, E(): 5.9e-65, (63.7% identity in 292 aa overlap); and other ABC-type sugar transport proteins. Also highly similar to O53482|Rv2038c|MTV018.25c ABC-type sugar transport protein from Mycobacterium tuberculosis (357 aa), FASTA scores: opt: 1248, E(): 9.4e-67, (56.8% identity in 354 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop), and PS00211 ABC transporters family signature. Belongs to the ATP-binding transport protein family (ABC transporters). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3138099 | 3139181 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2832c|ugpC
MANVQYSAVTQRYPGADAPTVDNLDLDIADGEFLVLVGPSGCGKSTTLRVLAGLEPIESGRISIGDVDVTHLPPRARDVAMVFQNYALYPNMTVAANMGFALRNAGMSRADTRRRVLEVADMLELTDLLDRKPAKLSGGQRQRVAMGRAIVRRPRVFCMDEPLSNLDAKLRVSTRSQISGLQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGVLQQVDTPRALYDDPVNTFVATFIGAPAMNLIDAAVAHGVVRAPDLAIPVPDPAAERVLVGVRPESWDVASIGTPGSLTVHVELVEELGFESFVYATPVDQRGWSSRAPRIVFRTDRRTAVRVGESLAIVPHSQEVRLFNSRTETRLR
Bibliography
- Schlösser A et al. [1997]. The Streptomyces ATP-binding component MsiK assists in cellobiose and maltose transport. Secondary
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
