Gene Mb2856c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE Sn-GLYCEROL-3-PHOSPHATE TRANSPORT ATP-BINDING PROTEIN ABC TRANSPORTER UGPC |
| Comments | Mb2856c, ugpC, len: 360 aa. Equivalent to Rv2832c,len: 360 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 360 aa overlap). Probable ugpC,Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter (see first citation below), similar to others: CAC48805 PROBABLE GLYCEROL-3-PHOSPHATE ABC TRANSPORTER ATP-BINDING PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (349 aa), FASTA scores: opt: 1018,E(): 4.1e-53, (48.6% identity in 356 aa overlap); Q98G42|MLL3499|UGPC SN-GLYCEROL-3-PHOSPHATE TRANSPORT ATP-BINDING PROTEIN from Rhizobium loti (Mesorhizobium loti) (366 aa), FASTA scores: opt: 1016, E(): 5.6e-53,(48.5% identity in 367 aa overlap). But also highly similar to many msiK proteins, ABC transporter ATP-binding proteins possibly involved in transport of cellolbiose and maltose (see second citation below) e.g. P96483|MSIK MSIK PROTEIN from Streptomyces reticuli (see citation below) (377 aa), FASTA scores: opt: 1277, E(): 1.9e-68, (58.05% identity in 379 aa overlap); Q9L0Q1|MSIK ABC TRANSPORTER ATP-BINDING PROTEIN from Streptomyces coelicolor (378 aa),FASTA scores: opt: 1276, E(): 2.1e-68, (57.65% identity in 380 aa overlap); Q54333|MSIK from Streptomyces lividans (314 aa), FASTA scores: opt: 1217, E(): 5.9e-65, (63.7% identity in 292 aa overlap); and other ABC-TYPE SUGAR TRANSPORT PROTEINS. Also highly similar to O53482|Rv2038c|MTV018.25c ABC-TYPE SUGAR TRANSPORT PROTEIN from Mycobacterium tuberculosis (357 aa), FASTA scores: opt: 1248, E(): 9.4e-67, (56.8% identity in 354 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop), and PS00211 ABC transporters family signature. BELONG TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3094670 | 3095752 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2856c|ugpC
MANVQYSAVTQRYPGADAPTVDNLDLDIADGEFLVLVGPSGCGKSTTLRVLAGLEPIESGRISIGDVDVTHLPPRARDVAMVFQNYALYPNMTVAANMGFALRNAGMSRADTRRRVLEVADMLELTDLLDRKPAKLSGGQRQRVAMGRAIVRRPRVFCMDEPLSNLDAKLRVSTRSQISGLQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGVLQQVDTPRALYDDPVNTFVATFIGAPAMNLIDAAVAHGVVRAPDLAIPVPDPAAERVLVGVRPESWDVASIGTPGSLTVHVELVEELGFESFVYATPVDQRGWSSRAPRIVFRTDRRTAVRVGESLAIVPHSQEVRLFNSRTETRLR
Bibliography
No article yet recorded