Gene Rv2836c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; induction by DNA damage. |
| Product | Possible DNA-damage-inducible protein F DinF |
| Comments | Rv2836c, (MTCY16B7.06), len: 439 aa. Possible dinF, DNA-damage-inducible protein F, integral membrane protein, similar to others e.g. BAB38450|ECS5027|AAG59243 from Escherichia coli strain O157:H7 (459 aa), FASTA scores: opt: 501, E(): 2.7e-21, (29.55% identity in 443 aa overlap); P28303|DINF_ECOLI|B4044 from Escherichia coli strain K12 (459 aa), FASTA scores: opt: 491, E(): 1e-20, (29.35% identity in 443 aa overlap); Q98B90|MLR5680 from Rhizobium loti (Mesorhizobium loti) (471 aa), FASTA scores: opt: 466, E(): 2.7e-19, (30.7% identity in 433 aa overlap); etc. But also similar or highly similar to other hypothetical proteins e.g. Q9X8U6|SCH24.32c hypothetical 46.3 KDA protein from Streptomyces coelicolor (448 aa), FASTA scores: opt: 981, E(): 1.1e-48, (42.35% identity in 437 aa overlap). Contains PS00213 Lipocalin signature. |
| Functional category | Information pathways |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3142309 | 3143628 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2836c|dinF
LSQVGHRAGGRQIAQLALPALGVLAAEPLYLLFDIAVVGRLGAISLAGLAIGSLVLGLVGSQATFLSYGTTARAARRYGAGNRVAAVTEGVQATWLALGLGALVVVVVEATATPLVSAIASGDGITAAALPWLRIAILGTPAILVSLAGNGWLRGVQDTVRPLRYVVAGFGSSALLCPLLVYGWLGLPRWGLTGSAVANLVGQWLAALLFAGALLAERVSLRPDRAVLGAQLMMARDLIVRTLAFQVCYVSAAAVAARFGAAALAAHQVVLQLWGLLALVLDSLAIAAQSLVGAALGAGDAGHAKAVAWRVTAFSLLAAGILAAALGLGSSVLPGLFTDDRSVLAAIGVPWWFMVVQLPFAGIVFAVDGVLLGAGDAAFMRTATVASALVGFLPLVWLSLAYGWGLAGIWSGLGTFIVLRLIFVGWRAYSGRWAVTGAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant