Gene Rv2838c 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'terminal helix region of 16S SRNA. | 
| Product | Probable ribosome-binding factor a RbfA (P15B protein) | 
| Comments | Rv2838c, (MTCY16B7.04), len: 183 aa. Probable rbfA, ribosome-binding factor A, equivalent to Q9Z5I8|RBFA_MYCLE|ML1555|MLCB596.15 probable ribosome-binding factor a from Mycobacterium leprae (164 aa), FASTA scores: opt: 739, E(): 1.8e-40, (75.6% identity in 160 aa overlap). Also highly similar or similar to others e.g. Q9Z527|RBFA_STRCO|SC9F2.08c from Streptomyces coelicolor (160 aa), FASTA scores: opt: 425, E(): 2.8e-20, (50.35% identity in 141 aa overlap); P32731|RBFA_BACSU from Bacillus subtilis (117 aa), FASTA scores: opt: 199, E(): 7.8e-06, (32.4% identity in 108 aa overlap); P09170|RBFA_ECOLI|P15B|B3167 from Escherichia coli strain K12 (132 aa), FASTA scores: opt: 166, E(): 0.0011, (29.65% identity in 118 aa overlap); etc. Belongs to the RBFA family. Note that appears to be longer in C-terminus than other RbfA proteins. | 
| Functional category | Information pathways | 
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). | 
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3144620 | 3145171 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2838c|rbfA
MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE
      
    Bibliography
    - Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant