Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionAssociates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'terminal helix region of 16S SRNA.
ProductProbable ribosome-binding factor a RbfA (P15B protein)
CommentsRv2838c, (MTCY16B7.04), len: 183 aa. Probable rbfA, ribosome-binding factor A, equivalent to Q9Z5I8|RBFA_MYCLE|ML1555|MLCB596.15 probable ribosome-binding factor a from Mycobacterium leprae (164 aa), FASTA scores: opt: 739, E(): 1.8e-40, (75.6% identity in 160 aa overlap). Also highly similar or similar to others e.g. Q9Z527|RBFA_STRCO|SC9F2.08c from Streptomyces coelicolor (160 aa), FASTA scores: opt: 425, E(): 2.8e-20, (50.35% identity in 141 aa overlap); P32731|RBFA_BACSU from Bacillus subtilis (117 aa), FASTA scores: opt: 199, E(): 7.8e-06, (32.4% identity in 108 aa overlap); P09170|RBFA_ECOLI|P15B|B3167 from Escherichia coli strain K12 (132 aa), FASTA scores: opt: 166, E(): 0.0011, (29.65% identity in 118 aa overlap); etc. Belongs to the RBFA family. Note that appears to be longer in C-terminus than other RbfA proteins.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31446203145171-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2838c|rbfA
MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE