Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionAcetylation, substrate unknown
ProductGCN5-related N-acetyltransferase
CommentsRv2851c, (MTCY24A1.06), len: 156 aa. Probable acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Similar to others e.g. Q9KP14|VC2565 ELAA protein from Vibrio cholerae (149 aa), FASTA scores: opt: 360, E(): 1e-18, (46.05% identity in 139 aa overlap); Q9I717|PA0115 hypothetical protein from Pseudomonas aeruginosa (150 aa), FASTA scores: opt: 341, E(): 2.4e-17, (43.65% identity in 142 aa overlap); Q9K8M4|BH2982 hypothetical protein from Bacillus halodurans (155 aa), FASTA scores: opt: 320, E(): 8e-16, (40.85% identity in 142 aa overlap); P52077|ELAA_ECOLI|B2267 protein ELAA from Escherichia coli strain K12 (153 aa), FASTA scores: opt: 269, E(): 3.8e-12, (35.7% identity in 140 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31600513160521-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2851c|Rv2851c
MTEALRRVWAKDLDARALYELLKLRVEVFVVEQACPYPELDGRDLLAETRHFWLETPDGEVTCTLRLMEEHAGGEKVFRIGRLCTKRDARGQGHSNRLLCAALAEVGDYPCRIDAQAYLTAMYAQHGFVRDGDEFLDDGIPHVPMLRPGSGQVERP