Gene Mb2876c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | gcn5-related n-acetyltransferase |
| Comments | Mb2876c, -, len: 156 aa. Equivalent to Rv2851c,len: 156 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 156 aa overlap). Conserved hypothetical protein, similar to various bacterial proteins e.g. Q9KP14|VC2565 ELAA PROTEIN from Vibrio cholerae (149 aa), FASTA scores: opt: 360, E(): 1e-18,(46.05% identity in 139 aa overlap); Q9I717|PA0115 HYPOTHETICAL PROTEIN from Pseudomonas aeruginosa (150 aa),FASTA scores: opt: 341, E(): 2.4e-17, (43.65% identity in 142 aa overlap); Q9K8M4|BH2982 HYPOTHETICAL PROTEIN from Bacillus halodurans (155 aa), FASTA scores: opt: 320, E(): 8e-16, (40.85% identity in 142 aa overlap); P52077|ELAA_ECOLI|B2267 PROTEIN ELAA from Escherichia coli strain K12 (153 aa), FASTA scores: opt: 269, E(): 3.8e-12,(35.7% identity in 140 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3116567 | 3117037 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2876c|Mb2876c
MTEALRRVWAKDLDARALYELLKLRVEVFVVEQACPYPELDGRDLLAETRHFWLETPDGEVTCTLRLMEEHAGGEKVFRIGRLCTKRDARGQGHSNRLLCAALAEVGDYPCRIDAQAYLTAMYAQHGFVRDGDEFLDDGIPHVPMLRPGSGQVERP
Bibliography
No article yet recorded