Gene Rv2862A
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible antitoxin VapB23 |
Comments | Rv2862A, len: 82 aa. Possible vapB23, antitoxin, part of toxin-antitoxin (TA) operon with Rv2863 (See Pandey and Gerdes, 2005). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3174747 | 3174995 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2862A|vapB23 ILSDEEREAFRQQAAAQQMSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPDETGAEPDWQAHLQVMAESRRRGLPAP
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function