Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductToxin RelG
CommentsRv2866, (MTV003.12), len: 87 aa. RelG, toxin, part of toxin-antitoxin (TA) operon with Rv2865 (See Pandey and Gerdes, 2005), similar to O50461|Rv1246c|MTV006.18c conserved hypothetical protein from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E(): 3.6e-16, (54.1% identity in 85 aa overlap).
Functional category-
OperonRv2865 and Rv2866 are co-transcribed, by RT-PCR (See Korch et al., 2009).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis H37Rv relE2|Rv2866 mutant is comparable to wild-type in vitro, in J774.1 macrophages, and in C57BL/6 mice; survival in rifampin-treated C57BL/6 mice is comparable to wild-type (See Singh et al., 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31778223178085+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2866|relG
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
      
Bibliography