Gene Rv2875 (mpb70)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Major secreted immunogenic protein Mpt70 |
| Comments | Rv2875, (MTCY274.06), len: 193 aa. Mpt70 (alternate gene name: mpb70), major secreted immunogenic protein MPT70 precursor (see citations below). Also similar to downstream ORF Q10790|MP83_MYCTU|MPT83|MPB83|Rv2873|MT2940|MTCY274.04 cell surface lipoprotein MPT83 precursor (lipoprotein P23) (220 aa), FASTA scores: opt: 806, E(): 1.2e-40, (70.25% identity in 185 aa overlap). Belongs to the MPT70 / MPT83 family. Generally found as a monomer; homodimer in culture fluids. |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h of starvation (see Betts et al., 2002). DNA microarrays show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3187030 | 3187611 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2875|mpt70
MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPVAVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFAPTNAAFSKLPASTIDELKTNSSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA
Bibliography
- Radford AJ et al. [1988]. Cloning of a species-specific antigen of Mycobacterium bovis. Homolog Sequence Product
- Radford AJ et al. [1990]. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis. Sequence Product
- Matsumoto S et al. [1995]. Cloning and sequencing of a unique antigen MPT70 from Mycobacterium tuberculosis H37Rv and expression in BCG using E. coli-mycobacteria shuttle vector. Sequence Product
- Matsuo T et al. [1995]. Differential transcription of the MPB70 genes in two major groups of Mycobacterium bovis BCG substrains. Sequence Secretion
- Juárez MD et al. [2001]. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. Sequence Regulation
- Lyashchenko KP et al. [2001]. Novel monoclonal antibodies against major antigens of Mycobacterium bovis. Homolog Product
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Carr MD et al. [2003]. Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Veyrier F, Said-Salim B and Behr MA [2008]. Evolution of the mycobacterial SigK regulon. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
