Gene Rv2877c (merT)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; possibly involved in transport of mercury across the membrane. |
| Product | Probable conserved integral membrane protein |
| Comments | Rv2877c, (MTCY274.08c), len: 287 aa. Probable conserved integral membrane protein, Mer family possibly involved in transport of mercury, similar to others, and to the fourth protein of the mercury resistance operon of Streptomyces sp (or other organisms), and to putative cytochrome-c biogenesis proteins e.g. Q9XBD1|CZA382.20C putative integral membrane transporter from Amycolatopsis orientalis (298 aa), FASTA scores: opt: 913, E(): 7.6e-46, (51.55% identity in 293 aa overlap); P30344|MER4_STRLI mercury resistance probable HG transport protein from Streptomyces lividans (319 aa), FASTA scores: opt: 427, E(): 1.2e-17, (32.85% identity in 289 aa overlap); Q9M5P3 putative cytochrome C biogenesis protein precursor from Arabidopsis thaliana (Mouse-ear cress) (354 aa), FASTA scores: opt: 229, E(): 4e-06, (29.85% identity in 221 aa overlap); etc. Contains PS00044 Bacterial regulatory proteins, lysR family signature. Note that previously known as merT. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3188008 | 3188871 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2877c|Rv2877c
VNEALIGLAFAAGLVAALNPCGFAMLPAYLLLVVYGQDSAGRTGPLSAVGRAAAATVGMALGFLTVFGIFGALTISAATAVQRYLPYATVLIGLALIALGGWLLLGRGLTALTPRSLGVRWAPTVRLGSMYGYGISYAVASLSCTIGPFLAVTGAGLRGGSVVGSVAIYLAYVAGLTLVVGVLAVAAATASSALADRLRRILPFVNRISGALLVVVGLYVGYYGLYELRLIAGVGANPQDAVIAAAGRLQGALAGWVNQHGAWPWAVLLVVLVVGAFAGTWFRRVRR
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
