Gene Rv2878c (dsbE)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Not really known. Despite a weak homology to thioredoxin this cannot serve as a substrate for thioredoxin reductase. Furthermore it has no disulfide reducing activity. |
| Product | Soluble secreted antigen Mpt53 precursor |
| Comments | Rv2878c, (MT2946, MTCY274.09c), len: 173 aa. Mpt53, secreted protein (contains N-terminal signal sequence) (see citations below). Shows some similarity with several disulfide bond interchange proteins e.g. P43787|THIX_HAEIN thioredoxin-like protein HI1115 from Haemophilus influenzae (167 aa), FASTA scores: opt: 200, E(): 1.4e-06, (28.9% identity in 135 aa overlap); P52237|TIPB_PSEFL thiol:disulfide interchange protein TIPB precursor (cytochrome C biogenesis protein TIPB) (178 aa), FASTA scores: opt: 184, E(): 1.8e-05, (26.3% identity in 171 aa overlap); etc. Also highly similar to O53924|DSBF|Rv1677|MTV047.12 putative lipoprotein from Mycobacterium tuberculosis (182 aa), FASTA scores: opt: 482, E(): 5.7e-26, (52.8% identity in 142 aa overlap). Could be belong to the thioredoxin family. Note that also previously known as dsbE. |
| Functional category | Cell wall and cell processes |
| Proteomics | The product of this CDS corresponds to spot 2878 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified in the culture filtrate of M. tuberculosis H37Rv using LC-MS/MS; antigen recognized by serum pool from tuberculosis patients (See Malen et al., 2008). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3188876 | 3189397 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2878c|mpt53
MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAALTS
Bibliography
- Wiker HG et al. [1999]. Cloning, expression and significance of MPT53 for identification of secreted proteins of Mycobacterium tuberculosis. Product Secretion Function
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I and Andersen P [2000]. Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Goulding CW et al. [2004]. Gram-positive DsbE proteins function differently from Gram-negative DsbE homologs. A structure to function analysis of DsbE from Mycobacterium tuberculosis. Structure
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Malen H, Softeland T and Wiker HG [2008]. Antigen analysis of Mycobacterium tuberculosis H37Rv culture filtrate proteins. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
