Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionNot really known. Despite a weak homology to thioredoxin this cannot serve as a substrate for thioredoxin reductase. Furthermore it has no disulfide reducing activity.
ProductSoluble secreted antigen Mpt53 precursor
CommentsRv2878c, (MT2946, MTCY274.09c), len: 173 aa. Mpt53, secreted protein (contains N-terminal signal sequence) (see citations below). Shows some similarity with several disulfide bond interchange proteins e.g. P43787|THIX_HAEIN thioredoxin-like protein HI1115 from Haemophilus influenzae (167 aa), FASTA scores: opt: 200, E(): 1.4e-06, (28.9% identity in 135 aa overlap); P52237|TIPB_PSEFL thiol:disulfide interchange protein TIPB precursor (cytochrome C biogenesis protein TIPB) (178 aa), FASTA scores: opt: 184, E(): 1.8e-05, (26.3% identity in 171 aa overlap); etc. Also highly similar to O53924|DSBF|Rv1677|MTV047.12 putative lipoprotein from Mycobacterium tuberculosis (182 aa), FASTA scores: opt: 482, E(): 5.7e-26, (52.8% identity in 142 aa overlap). Could be belong to the thioredoxin family. Note that also previously known as dsbE.
Functional categoryCell wall and cell processes
ProteomicsThe product of this CDS corresponds to spot 2878 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified in the culture filtrate of M. tuberculosis H37Rv using LC-MS/MS; antigen recognized by serum pool from tuberculosis patients (See Malen et al., 2008). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31888763189397-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2878c|mpt53
MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAALTS
      
Bibliography