Gene Rv2880c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2880c, (MTCY274.11c), len: 275 aa. Conserved hypothetical protein, highly similar in N-terminus to others e.g. O86754|SC6A9.22c hypothetical 40.4 KDA protein from Streptomyces coelicolor (368 aa), FASTA scores: opt: 663, E(): 2.6e-33, (52.6% identity in 213 aa overlap); Q55880|Y098_SYNY3|SLL0098 hypothetical 38.9 KDA protein from Synechocystis sp. strain PCC 6803 (350 aa), FASTA scores: opt: 362, E(): 7.3e-15, (38.9% identity in 162 aa overlap); O66732|AQ_416 hypothetical 40.2 KDA protein from Aquifex aeolicus (348 aa), FASTA scores: opt: 321, E(): 2.4e-12, (39.75% identity in 146 aa overlap); etc. Appears to be a frame shift with respect to preceding ORF but we can detect no error in the cosmid sequence to account for this. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3189851 | 3190678 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2880c|Rv2880c
MVPELMFDEPRPGRPPRHLADLDAAGRASAVAELGLPAFRAKQLAHQYYGRLIADPRQMTDLPAAVRDRIAGAMFPNLLTASADITCDAGQTRKTLWRAVDGTMFESVLMRYPRRNTVCISSQAGCGMACPFCATGQGGLTRNLSTAEILEQVRAGAAALRDDFGDRLSNVVFMGMGGAAGQLRQGVGRSSAHYRAAAVRFRDFGPRGDGVDGGSGPCYPQPCRRAARRDPGAVAARPRRRVARYTSSGQQPVEDQRSARCGPVLRQCDRATGVY
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
