Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2880c, (MTCY274.11c), len: 275 aa. Conserved hypothetical protein, highly similar in N-terminus to others e.g. O86754|SC6A9.22c hypothetical 40.4 KDA protein from Streptomyces coelicolor (368 aa), FASTA scores: opt: 663, E(): 2.6e-33, (52.6% identity in 213 aa overlap); Q55880|Y098_SYNY3|SLL0098 hypothetical 38.9 KDA protein from Synechocystis sp. strain PCC 6803 (350 aa), FASTA scores: opt: 362, E(): 7.3e-15, (38.9% identity in 162 aa overlap); O66732|AQ_416 hypothetical 40.2 KDA protein from Aquifex aeolicus (348 aa), FASTA scores: opt: 321, E(): 2.4e-12, (39.75% identity in 146 aa overlap); etc. Appears to be a frame shift with respect to preceding ORF but we can detect no error in the cosmid sequence to account for this.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31898513190678-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2880c|Rv2880c
MVPELMFDEPRPGRPPRHLADLDAAGRASAVAELGLPAFRAKQLAHQYYGRLIADPRQMTDLPAAVRDRIAGAMFPNLLTASADITCDAGQTRKTLWRAVDGTMFESVLMRYPRRNTVCISSQAGCGMACPFCATGQGGLTRNLSTAEILEQVRAGAAALRDDFGDRLSNVVFMGMGGAAGQLRQGVGRSSAHYRAAAVRFRDFGPRGDGVDGGSGPCYPQPCRRAARRDPGAVAARPRRRVARYTSSGQQPVEDQRSARCGPVLRQCDRATGVY