Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUridine monophosphate kinase [catalytic activity: ATP + UMP = ADP + UDP].
ProductProbable uridylate kinase PyrH (UK) (uridine monophosphate kinase) (UMP kinase)
CommentsRv2883c, (MT2951, MTCY274.14c), len: 261 aa. Probable pyrH, uridylate kinase, equivalent to O33045|PYRH_MYCLE|ML1591|MLCB250.75 uridylate kinase from Mycobacterium leprae (279 aa), FASTA scores: opt: 1437, E(): 3.8e-81, (85.05% identity in 274 aa overlap). Also highly similar to others e.g. O69913|PYRH from Streptomyces coelicolor (253 aa), FASTA scores: opt: 1086, E(): 1.4e-59, (68.9% identity in 251 aa overlap); P74457|PYRH_SYNY3|SLL0144 from Synechocystis sp. strain PCC 6803 (260 aa), FASTA scores: opt: 851, E(): 4.1e-45, (55.85% identity in 231 aa overlap); P29464|PYRH_ECOLI|SMBA|B0171|Z0182|ECS0173 from strains K12 and O157:H7 (240 aa), FASTA scores: opt: 666, E(): 1.1e-35, (45.7% identity in 232 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 3_236 identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (See Mattow et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31923733193158-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2883c|pyrH
MTEPDVAGAPASKPEPASTGAASAAQLSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQIADVVRGGVQIAVVIGGGNFFRGAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEDPRVNPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAVRGEKIGTLVTT
      
Bibliography