Gene Rv2884
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism |
| Product | Probable transcriptional regulatory protein |
| Comments | Rv2884, (MTCY274.15), len: 252 aa. Probable transcriptional regulatory protein, highly similar to others e.g. Q05943|GLNR_STRCO|SCD84.26c transcriptional regulatory protein from Streptomyces coelicolor (267 aa), FASTA scores: opt: 609, E(): 2.7e-34, (46.4% identity in 224 aa overlap); Q55733|SLL0396 regulatory components of sensory transduction system from Synechocystis sp. strain PCC 6803 (224 aa), FASTA scores: opt: 330, E(): 3e-15, (31.8% identity in 217 aa overlap); Q9A4S3|CC2757 DNA-binding response regulator from Caulobacter crescentus (223 aa), FASTA scores: opt: 311, E(): 6e-14, (30.3% identity in 221 aa overlap); etc. Also highly similar to O53830|Rv0818|MTV043.10 putative regulatory protein from Mycobacterium tuberculosis (255 aa), FASTA scores: opt: 665, E(): 3.8e-38, (47.6% identity in 227 aa overlap). The N-terminal region is similar to that of other regulatory components of sensory transduction systems. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3193393 | 3194151 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2884|Rv2884
MPTGPTTGKWHPHEVWRYLLEVLLLTDEADLESALPELESFAQSVQRAPLDDPGAAKGADADVAIIDARADLAAARRVCRRLTTSAPALAVVAVVAPANFVAVDGDWIFDDVLLNAAGGAELQARLRLAITRRRSTLAGTLQFGDLVLHPASYTASLGDRDLGLTLTEFKLMNFLVQHAGRAFTRTRLMREVWGYECHGRIRTVDVHVRRLRAKLGAEHESMIDTVRGVGYMAVTPPQPRWIISESILNRCK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
