Gene Rv2891
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2891, (MTCY274.22), len: 249 aa (C-terminus overlaps neigbouring ORF). Conserved hypothetical protein, similar in N-terminus to O69910|SC2E1.40c hypothetical 22.8 KDA protein from Streptomyces coelicolor (226 aa), FASTA scores: opt: 315, E(): 3.4e-11, (40.7% identity in 145 aa overlap). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3200266 | 3201015 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2891|Rv2891
LAKSPARRCTAKVRRVLSRSVLILCWSLLGAAPAHADDSRLGWPLRPPPAVVRQFDAASPNWNPGHRGVDLAGRPGQPVYAAGSATVVFAGLLAGRPVVSLAHPGGLRTSYEPVVAQVRVGQPVSAPTVIGALAAGHPGCQAAACLHWGAMWGPASGANYVDPLGLLKSTPIRLKPLSSEGRTLHYRQAEPVFVNEAAAGALAGAGHRKSPKQGVFRGAAQGGDIVARQPPGRWVCPSSAGGPIGWHRQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant