Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2891, (MTCY274.22), len: 249 aa (C-terminus overlaps neigbouring ORF). Conserved hypothetical protein, similar in N-terminus to O69910|SC2E1.40c hypothetical 22.8 KDA protein from Streptomyces coelicolor (226 aa), FASTA scores: opt: 315, E(): 3.4e-11, (40.7% identity in 145 aa overlap). Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32002663201015+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2891|Rv2891
LAKSPARRCTAKVRRVLSRSVLILCWSLLGAAPAHADDSRLGWPLRPPPAVVRQFDAASPNWNPGHRGVDLAGRPGQPVYAAGSATVVFAGLLAGRPVVSLAHPGGLRTSYEPVVAQVRVGQPVSAPTVIGALAAGHPGCQAAACLHWGAMWGPASGANYVDPLGLLKSTPIRLKPLSSEGRTLHYRQAEPVFVNEAAAGALAGAGHRKSPKQGVFRGAAQGGDIVARQPPGRWVCPSSAGGPIGWHRQ