Gene Rv2906c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Specifically methylates guanosime-37 in various TRNAS [catalytic activity S-adenosyl-L-methionine + tRNA = S-adenosyl-L-homocysteine + tRNA containing N1-methylguanine]. |
| Product | Probable tRNA (guanine-N1)-methyltransferase TrmD (M1G-methyltransferase) (tRNA [GM37] methyltransferase) |
| Comments | Rv2906c, (MTCY274.37c), len: 230 aa. Probable trmD, tRNA m1G methyltransferase, equivalent to O33017|TRMD_MYCLE from Mycobacterium leprae (238 aa), FASTA scores: opt: 1363, E(): 8.1e-86, (87.2% identity in 227 aa overlap). Also highly similar to others e.g. O69882|TRMD_STRCO from Streptomyces coelicolor and S. lividans (277 aa), FASTA scores: opt: 841, E(): 4.5e-50, (55.55% identity in 234 aa overlap); Q9A0B6 from Streptococcus pyogenes (243 aa), FASTA scores: opt: 698, E(): 2.5e-40, (47.6% identity in 227 aa overlap); P07020|TRMD_ECOLI|TRMD|B2607|Z3901|ECS3470 from Escherichia coli strain O157:H7 (255 aa), FASTA scores: opt: 573, E(): 3.8e-33, (42.1% identity in 228 aa overlap); etc. Belongs to the RNA methyltransferase TRMD family. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3215665 | 3216357 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2906c|trmD
VRIDIVTIFPACLDPLRQSLPGKAIESGLVDLNVHDLRRWTHDVHHSVDDAPYGGGPGMVMKAPVWGEALDEICSSETLLIVPTPAGVLFTQATAQRWTTESHLVFACGRYEGIDQRVVQDAARRMRVEEVSIGDYVLPGGESAAVVMVEAVLRLLAGVLGNPASHQDDSHSTGLDGLLEGPSYTRPASWRGLDVPEVLLSGDHARIAAWRREVSLQRTRERRPDLSHPD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
