Gene Rv2909c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanism. |
| Product | 30S ribosomal protein S16 RpsP |
| Comments | Rv2909c, (MTCY274.41c), len: 162 aa. rpsP, 30S ribosomal protein S16, equivalent to O33014|RS16_MYCLE 30S ribosomal protein S16 from Mycobacterium leprae (160 aa), FASTA scores: opt: 828, E(): 1.6e-39, (82.5% identity in 160 aa overlap). Also highly similar to others e.g. O69879|RS16_STRCO 30S ribosomal protein S16 from Streptomyces coelicolor (139 aa), FASTA scores: opt: 486, E(): 1.9e-20, (56.95% identity in 144 aa overlap); P80379|RS16_THETH 30S ribosomal protein S16 from Thermus Thermophilus (88 aa), FASTA scores: opt: 280, E(): 4.8e-09, (53.25% identity in 77 aa overlap) (C-terminus shorter); P21474|RS16_BACSU|RPSP 30S ribosomal protein S16 (BS17) from Bacillus subtilis (89 aa,), FASTA scores: opt: 258, E(): 8.2e-08, (42.85% identity in 91 aa overlap) (C-terminus shorter); etc. Belongs to the S16P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3217155 | 3217643 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2909c|rpsP
MAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKPSKLEVFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPALGGEQAELTAES
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sun R, Converse PJ, Ko C, Tyagi S, Morrison NE and Bishai WR [2004]. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Regulon
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant