Gene Rv2912c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in transcriptional mechanism. |
| Product | Probable transcriptional regulatory protein (probably TetR-family) |
| Comments | Rv2912c, (MTCY274.44c), len: 195 aa. Probable transcription regulatory protein, TetR family, showing similarity with others e.g. Q9K3V9|SCD10.17 putative TetR-family transcriptional from Streptomyces coelicolor (202 aa), FASTA scores: opt: 185, E(): 4.4e-05, (31.15% identity in 167 aa overlap); Q9KFQ0 TetR-family from Bacillus halodurans (185 aa), FASTA scores: opt: 164, E(): 0.001, (35.6% identity in 73 aa overlap); P17446|BETI_ECOLI|BETI|B0313 regulatory protein from Escherichia coli strain K12 (195 aa), FASTA scores: opt: 126, E(): 0.024, (24.5% identity in 196 aa overlap); etc. Contains possible helix-turn-helix motif at aa 33-54 (+2.71 SD). Possibly belongs to the TetR/AcrR family. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3219274 | 3219861 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2912c|Rv2912c
MARTQQQRREETVARLLQASIDTIIEVGYARASAAVITKRAGVSVGALFRHFETMGDFMAATAYEVLRRQLETFTKQVAEIPADRPALPAALTILRDITAGSTNAVLYELMVAARTDEKLKETLQNVLGQYSAKIHDAARALPGAESFPEETFPVIVALMTNVFDGAAIVRGVLPQPELEEQRIPMLTALLTAGL
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant