Gene Rv2965c (coaD)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the coenzyme A (CoA) biosynthesis (at the fourth step). Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (DPCOA) and pyrophosphate [catalytic activity: ATP + pantetheine 4'-phosphate = diphosphate + dephospho-CoA]. |
| Product | Probable phosphopantetheine adenylyltransferase KdtB (pantetheine- phosphate adenylyltransferase) (PPAT) (dephospho-CoA pyrophosphorylase) |
| Comments | Rv2965c, (MTCY349.22), len: 161 aa. Probable kdtB (alternate gene name: coaD), phosphopantetheine adenylyltransferase, equivalent to O69466|COAD_MYCLE phosphopantetheine adenylyltransferase from Mycobacterium leprae (160 aa), FASTA scores: opt: 881, E(): 2.5e-54, (84.1% identity in 157 aa overlap). Also highly similar to others e.g. Q9ZBR1|COAD_STRCO from Streptomyces coelicolor (159 aa), FASTA scores: opt: 575, E(): 5.8e-33, (54.1% identity in 159 aa overlap); Q9WZK0|COAD_THEMA from Thermotoga maritima (161 aa), FASTA scores: opt: 509, E(): 2.4e-28, (50.0% identity in 154 aa overlap); P23875|COAD_ECOLICOAD|KDTB|B3634|Z5058|ECS4509 from Escherichia coli strain O157:H7 and K12 (159 aa), FASTA scores: opt: 459, E(): 7.3e-25, (45.15% identity in 155 aa overlap); etc. Belongs to the CoaD family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3318330 | 3318815 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2965c|kdtB
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Morris VK et al. [2004]. Substrate-induced asymmetry and channel closure revealed by the apoenzyme structure of Mycobacterium tuberculosis phosphopantetheine adenylyltransferase. Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant