Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the coenzyme A (CoA) biosynthesis (at the fourth step). Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (DPCOA) and pyrophosphate [catalytic activity: ATP + pantetheine 4'-phosphate = diphosphate + dephospho-CoA].
ProductProbable phosphopantetheine adenylyltransferase KdtB (pantetheine- phosphate adenylyltransferase) (PPAT) (dephospho-CoA pyrophosphorylase)
CommentsRv2965c, (MTCY349.22), len: 161 aa. Probable kdtB (alternate gene name: coaD), phosphopantetheine adenylyltransferase, equivalent to O69466|COAD_MYCLE phosphopantetheine adenylyltransferase from Mycobacterium leprae (160 aa), FASTA scores: opt: 881, E(): 2.5e-54, (84.1% identity in 157 aa overlap). Also highly similar to others e.g. Q9ZBR1|COAD_STRCO from Streptomyces coelicolor (159 aa), FASTA scores: opt: 575, E(): 5.8e-33, (54.1% identity in 159 aa overlap); Q9WZK0|COAD_THEMA from Thermotoga maritima (161 aa), FASTA scores: opt: 509, E(): 2.4e-28, (50.0% identity in 154 aa overlap); P23875|COAD_ECOLICOAD|KDTB|B3634|Z5058|ECS4509 from Escherichia coli strain O157:H7 and K12 (159 aa), FASTA scores: opt: 459, E(): 7.3e-25, (45.15% identity in 155 aa overlap); etc. Belongs to the CoaD family.
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33183303318815-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2965c|kdtB
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT