Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv2968c, (MTCY349.19), len: 210 aa. Probable conserved integral membrane protein, equivalent to O69464 putative integral membrane protein from Mycobacterium leprae (214 aa), FASTA scores: opt: 1060, E(): 1.4e-58, (71.95% identity in 214 aa overlap). Also highly similar to others e.g. Q9F844 hypothetical integral membrane protein from Mycobacterium smegmatis (187 aa), FASTA scores: opt: 883, E(): 1.2e-47, (62.8% identity in 190 aa overlap); Q9KXP3 putative integral membrane protein from Streptomyces coelicolor (240 aa), FASTA scores: opt: 503, E(): 4.6e-24, (38.0% identity in 192 aa overlap); etc.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33230713323703-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2968c|Rv2968c
VVAARPAERSGDPAAVRVPVPSAWWVLIGGVIGLFASMTLTVEKVRILLDPIYVPSCNVNPIVSCGSVMTTPQASLLGFPNPLLGIAGFTVVVVTGVLAVAKVPLPRWYWIGLAVGILVGVAFVHWLIFQSLYRIGALCPYCMVVWAVIATLLVVVASIVFGPMRENRGSQERVGARLLYQWRWSLATLWFTTVFLLIMVRFWDYWSTLI