Gene Rv2970A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2970A, len: 56 aa. Conserved hypothetical protein, similar to C-terminal part of several oxidoreductases e.g. Rv2971|Z83018|MTCY349_22 from Mycobacterium tuberculosis (282 aa), FASTA scores: opt: 158, E(): 3.6e-06, (45.0% identity in 60 aa overlap). May represent a gene fragment. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3325934 | 3326104 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2970A|Rv2970A
VLIRWHIQLGNIVIPKSVNPMRIASNFDAFDFPRSMTEPGLVRIRKPSISQAGEMT
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
