Gene Rv2975c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2975c, (MTCY349.12), len: 84 aa. Conserved hypothetical protein, similar to N-terminus of others e.g. Q9ZBR4|SC7A1.09 hypothetical 59.5 KDA protein from Streptomyces coelicolor (589 aa), FASTA scores: opt: 141, E(): 0.0019, (41.25% identity in 80 aa overlap); Q98R49|MYPU_1610 hypothetical protein from Mycoplasma pulmonis (545 aa), FASTA scores: opt: 127, E(): 0.023, (48.0% identity in 50 aa overlap); Q9K9Z6|BH2498 hypothetical protein from Bacillus halodurans (557 aa), FASTA scores: opt: 126, E(): 0.028, (34.55% identity in 81 aa overlap); etc. Also some similarity with N-terminus of P47609|Y369_MYCGE|MG369 hypothetical protein from Mycoplasma genitalium (557 aa), FASTA scores: opt: 108, E(): 0.7, (36.75% identity in 49 aa overlap); this, and preceding ORF, are similar to Y369_MYCGE and YLOV protein but no cosmid sequence error was identified. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3331358 | 3331612 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2975c|Rv2975c
VGTADRPLDASALRDWAHAVVSDLILHIDEINRLNVFPVADSDTGVNMLFTMRAAVVEADLHANSQADAEDVARVAAALAAGAR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
