Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2975c, (MTCY349.12), len: 84 aa. Conserved hypothetical protein, similar to N-terminus of others e.g. Q9ZBR4|SC7A1.09 hypothetical 59.5 KDA protein from Streptomyces coelicolor (589 aa), FASTA scores: opt: 141, E(): 0.0019, (41.25% identity in 80 aa overlap); Q98R49|MYPU_1610 hypothetical protein from Mycoplasma pulmonis (545 aa), FASTA scores: opt: 127, E(): 0.023, (48.0% identity in 50 aa overlap); Q9K9Z6|BH2498 hypothetical protein from Bacillus halodurans (557 aa), FASTA scores: opt: 126, E(): 0.028, (34.55% identity in 81 aa overlap); etc. Also some similarity with N-terminus of P47609|Y369_MYCGE|MG369 hypothetical protein from Mycoplasma genitalium (557 aa), FASTA scores: opt: 108, E(): 0.7, (36.75% identity in 49 aa overlap); this, and preceding ORF, are similar to Y369_MYCGE and YLOV protein but no cosmid sequence error was identified.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33313583331612-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2975c|Rv2975c
VGTADRPLDASALRDWAHAVVSDLILHIDEINRLNVFPVADSDTGVNMLFTMRAAVVEADLHANSQADAEDVARVAAALAAGAR