Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in base excision repair.excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.
ProductProbable uracil-DNA glycosylase Ung (UDG)
CommentsRv2976c, (MTCY349.11), len: 227 aa. Probable ung, uracil-DNA glycosylase (see citation below), equivalent to Q9CBS3 uracil-DNA glycosylase from Mycobacterium leprae (227 aa), FASTA scores: opt: 1394, E(): 8.8e-85, (88.1% identity in 227 aa overlap). Also highly similar to others e.g. Q9EX12 from Streptomyces coelicolor (225 aa), FASTA scores: opt: 1134, E(): 1.3e-67, (72.75% identity in 224 aa overlap); Q9K682|UNG_BACHD from Bacillus halodurans (224 aa), FASTA scores: opt: 652, E(): 8.9e-36, (45.5% identity in 222 aa overlap); P39615|UNG_BACSU from Bacillus subtilis (225 aa), FASTA scores: opt: 625, E(): 5.4e-34, (45.5% identity in 222 aa overlap); etc. Belongs to the uracil-DNA glycosylase family.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33320713332754-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2976c|ung
VTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP