Gene Rv2979c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Prevents the cointegration of foreign DNA before integration into the chromosome. |
| Product | Probable resolvase |
| Comments | Rv2979c, (MTCY349.08), len: 194 aa. Probable resolvase for IS1538, with low level matches to transposon resolvases; highly similar from aa 101 to YX1C_MYCTU|Q10831 from Mycobacterium tuberculosis (295 aa), FASTA scores: opt: 809, E(): 0, (69.1% identity in 194 aa overlap). Contains PS00397 Site-specific recombinases active site, and possible helix-turn-helix motiv at aa 2-23. |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3335164 | 3335748 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2979c|Rv2979c
MNLATWAERNGVAPGTAYRWFRAGLLSVMARRVGRLILVDEPAGDAGMRSPTAVYARVSSADQKADLDRQVARVTAWATAQQMPVDKVVTEVGSAFNEHRRKFLSLLRDPSVHRIVVEHRDRFCRLGSKYVQAAFAAQGRELVVVDSAEVDDDLVRDMTEILTSMCARLYGKRAAENRTKRALAAAAGEDHEAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
