Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPrevents the cointegration of foreign DNA before integration into the chromosome.
ProductProbable resolvase
CommentsRv2979c, (MTCY349.08), len: 194 aa. Probable resolvase for IS1538, with low level matches to transposon resolvases; highly similar from aa 101 to YX1C_MYCTU|Q10831 from Mycobacterium tuberculosis (295 aa), FASTA scores: opt: 809, E(): 0, (69.1% identity in 194 aa overlap). Contains PS00397 Site-specific recombinases active site, and possible helix-turn-helix motiv at aa 2-23.
Functional categoryInsertion seqs and phages
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33351643335748-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2979c|Rv2979c
MNLATWAERNGVAPGTAYRWFRAGLLSVMARRVGRLILVDEPAGDAGMRSPTAVYARVSSADQKADLDRQVARVTAWATAQQMPVDKVVTEVGSAFNEHRRKFLSLLRDPSVHRIVVEHRDRFCRLGSKYVQAAFAAQGRELVVVDSAEVDDDLVRDMTEILTSMCARLYGKRAAENRTKRALAAAAGEDHEAA