Gene Rv2985
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; hydrolytic enzyme. Possibly involved in removal of damaged nucleotide. |
| Product | Possible hydrolase MutT1 |
| Comments | Rv2985, (MTCY349.02c), len: 317 aa. Possible mutT1, long MutT protein (hydrolase) (see citation below), highly similar to O33126|MLCB637.35 hypothetical 34.5 KDA protein from Mycobacterium leprae (312 aa), FASTA scores: opt: 1514, E(): 5.1e-91, (71.85% identity in 316 aa overlap); and Q9CBR8|ML1682 hypothetical protein from Mycobacterium leprae (311 aa), FASTA scores: opt: 1510, E(): 9.2e-91, (71.5% identity in 316 aa overlap). Also similar to Q50195|L222-ORF6|ML2698 hypothetical protein from Mycobacterium leprae (251 aa), FASTA scores: opt: 231, E(): 1.1e-07, (36.7% identity in 128 aa overlap). Also similar to shorter mutt proteins and related hypothetical protein e.g. Q9EUS6 hypothetical 16.6 KDA protein from Streptomyces griseus subsp. griseus (152 aa), FASTA scores: opt: 380, E(): 1.7e-17, (50.75% identity in 130 aa overlap); Q9KZV8|SCD84.10C putative mutt-like protein from Streptomyces coelicolor (142 aa), FASTA scores: opt: 376, E(): 2.9e-17, (46.1% identity in 128 aa overlap); P96590|mutt mutt protein from Bacillus subtilis (149 aa), FASTA scores: opt: 180, E(): 0.00017, (35.25% identity in 122 aa overlap); etc. Also similar to O05437 hypothetical 27.1 KDA protein from Mycobacterium tuberculosis (248 aa), FASTA scores: opt: 224, E(): 3.2e-07, (34.03% identity in 144 aa overlap). Contains PS00893 mutT domain signature. Seems to belong to the mutt/NUDIX family protein. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3342165 | 3343118 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2985|mutT1
VSIQNSSARRRSAGRIVYAAGAVLWRPGSADSEGPVEIAVIHRPRYDDWSLPKGKVDPGETAPVGAVREILEETGHRANLGRRLLTVTYPTDSPFRGVKKVHYWAARSTGGEFTPGSEVDELIWLPVPDAMNKLDYAQDRKVLCRFAKHPADTQTVLVVRHGTAGSKAHFSGDDSKRPLDKRGRAQAEALVPQLLAFGATDVYAADRVRCHQTMEPLAAELNVTIHNEPTLTEESYANNPKRGRHRVLQIVEQVGTPVICTQGKVIPDLITWWCERDGVHPDKSRNRKGSTWVLSLSAGRLVTADHIGGALAANVRA
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Dos Vultos T, Blazquez J, Rauzier J, Matic I and Gicquel B [2006]. Identification of Nudix hydrolase family members with an antimutator role in Mycobacterium tuberculosis and Mycobacterium smegmatis. Biochemistry Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
