Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; hydrolytic enzyme. Possibly involved in removal of damaged nucleotide.
ProductPossible hydrolase MutT1
CommentsRv2985, (MTCY349.02c), len: 317 aa. Possible mutT1, long MutT protein (hydrolase) (see citation below), highly similar to O33126|MLCB637.35 hypothetical 34.5 KDA protein from Mycobacterium leprae (312 aa), FASTA scores: opt: 1514, E(): 5.1e-91, (71.85% identity in 316 aa overlap); and Q9CBR8|ML1682 hypothetical protein from Mycobacterium leprae (311 aa), FASTA scores: opt: 1510, E(): 9.2e-91, (71.5% identity in 316 aa overlap). Also similar to Q50195|L222-ORF6|ML2698 hypothetical protein from Mycobacterium leprae (251 aa), FASTA scores: opt: 231, E(): 1.1e-07, (36.7% identity in 128 aa overlap). Also similar to shorter mutt proteins and related hypothetical protein e.g. Q9EUS6 hypothetical 16.6 KDA protein from Streptomyces griseus subsp. griseus (152 aa), FASTA scores: opt: 380, E(): 1.7e-17, (50.75% identity in 130 aa overlap); Q9KZV8|SCD84.10C putative mutt-like protein from Streptomyces coelicolor (142 aa), FASTA scores: opt: 376, E(): 2.9e-17, (46.1% identity in 128 aa overlap); P96590|mutt mutt protein from Bacillus subtilis (149 aa), FASTA scores: opt: 180, E(): 0.00017, (35.25% identity in 122 aa overlap); etc. Also similar to O05437 hypothetical 27.1 KDA protein from Mycobacterium tuberculosis (248 aa), FASTA scores: opt: 224, E(): 3.2e-07, (34.03% identity in 144 aa overlap). Contains PS00893 mutT domain signature. Seems to belong to the mutt/NUDIX family protein.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33421653343118+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2985|mutT1
VSIQNSSARRRSAGRIVYAAGAVLWRPGSADSEGPVEIAVIHRPRYDDWSLPKGKVDPGETAPVGAVREILEETGHRANLGRRLLTVTYPTDSPFRGVKKVHYWAARSTGGEFTPGSEVDELIWLPVPDAMNKLDYAQDRKVLCRFAKHPADTQTVLVVRHGTAGSKAHFSGDDSKRPLDKRGRAQAEALVPQLLAFGATDVYAADRVRCHQTMEPLAAELNVTIHNEPTLTEESYANNPKRGRHRVLQIVEQVGTPVICTQGKVIPDLITWWCERDGVHPDKSRNRKGSTWVLSLSAGRLVTADHIGGALAANVRA