Gene Rv2998A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sensor proteins e.g. O07777|Rv0601c|MTCY19H5.21 two component sensor (fragment) from Mycobacterium tuberculosis (156 aa), FASTA scores: opt: 212, E(): 3.7e-09, (58.2% identity in 67 aa overlap); Q9L2B6|SC8F4.08 probable two-component sensor kinase from Streptomyces coelicolor (478 aa), FASTA scores: opt: 193, E(): 2.6e-07, (47.05% identity in 68 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3357225 | 3357428 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2998A|Rv2998A
VERMRIRAAGISATDPHARLPLPLARDEIRYLGTTFNDLLQRLQDALERERQFVSDAGHELRTPLAS
Bibliography
No article yet recorded