Gene Rv3004
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown function (putative secreted protein). |
| Product | Low molecular weight protein antigen 6 (CFP-6) |
| Comments | Rv3004, (MT3084.1, MTV012.18), len: 112 aa. Cfp6, low molecular weight protein antigen 6 (CFP-6) (See Bhaskar et al., 2000). Weak homology with Q9RKZ5|SC6D7.02 putative membrane protein from Streptomyces coelicolor (156 aa), FASTA scores: opt: 109, E(): 0.78, (39.4% identity in 122 aa overlap). Caution: the initiator methionine may be further upstream making the sequence a precursor. Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Cell wall and cell processes |
| Proteomics | Purified from culture filtrate (See Bhaskar et al., 2000). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3363348 | 3363686 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3004|cfp6
MAHFAVGFLTLGLLVPVLTWPVSAPLLVIPVALSASIIRLRTLADERGVTVRTLVGSRAVRWDDIDGLRFHRGSWARATLKDGTELRLPAVTFATLPHLTEASSGRVPNPYR
Bibliography
- Bhaskar S et al. [2000]. Isolation, purification and immunological characterization of novel low molecular weight protein antigen CFP 6 from culture filtrate of M. tuberculosis. Product Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
