Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown function (putative secreted protein).
ProductLow molecular weight protein antigen 6 (CFP-6)
CommentsRv3004, (MT3084.1, MTV012.18), len: 112 aa. Cfp6, low molecular weight protein antigen 6 (CFP-6) (See Bhaskar et al., 2000). Weak homology with Q9RKZ5|SC6D7.02 putative membrane protein from Streptomyces coelicolor (156 aa), FASTA scores: opt: 109, E(): 0.78, (39.4% identity in 122 aa overlap). Caution: the initiator methionine may be further upstream making the sequence a precursor. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryCell wall and cell processes
ProteomicsPurified from culture filtrate (See Bhaskar et al., 2000). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33633483363686+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3004|cfp6
MAHFAVGFLTLGLLVPVLTWPVSAPLLVIPVALSASIIRLRTLADERGVTVRTLVGSRAVRWDDIDGLRFHRGSWARATLKDGTELRLPAVTFATLPHLTEASSGRVPNPYR