Gene Rv3007c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible oxidoreductase |
| Comments | Rv3007c, (MTV012.21c), len: 204 aa. Possible oxidoreductase, similar to Q9EWU5|3SC5B7.04c putative oxidoreductase from Streptomyces coelicolor (162 aa), FASTA scores: opt: 376, E(): 1.5e-18, (41.35% identity in 150 aa overlap); Q9K416|SCG22.29c putative flavin-dependent reductase protein from Streptomyces coelicolor (169 aa), FASTA scores: opt: 246, E(): 1e-09, (34.1% identity in 135 aa overlap); and some similarity to coupling proteins of 4-hydroxyphenylacetic hydroxylase/monooxygenase e.g. Q9HWT6|HPAC|PA4092 Pseudomonas aeruginosa (170 aa), FASTA score: opt: 214; O68232|HPAC Photorhabdus luminescens (Xenorhabdus luminescens) (172 aa), FASTA score: opt: 198; Q9RPU2|HPAC Salmonella dublin (170 aa), FASTA score: opt: 197; etc. Equivalent to AAK47416 from Mycobacterium tuberculosis strain CDC1551 (236 aa) but shorter 32 aa. Start chosen by similarity. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3365836 | 3366450 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3007c|Rv3007c
VSEDVARIHDGDVIDESFDELMGMLDHPVFVVTTQADGHPAGCLVSFATQTSVQPPSFMVGLPRSTGTSEVASRSEHLAVHVLSQRQHVLAELFGSQTEEEVNKFARCSWRAGPCGMPILDDAAAWFIGRTASRSDVGDYVAYLLEPVSVWAPECSEDLLYLSDLDFDVDDIDPGKEASPRFYERERGDETRRYGVVRFTLDVP
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
